PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009604784.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 421aa    MW: 47611.8 Da    PI: 8.5376
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009604784.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.37.5e-50421681128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                     + pGfrF Ptdeel+++yLkkk+eg++  + evi+ev+i k+ePwdLp k++ ++++ew+fFs+r +ky++g++++rat+sgyWkatgk+++v+s
  XP_009604784.1  42 MFPGFRFCPTDEELISYYLKKKLEGSDKCV-EVISEVEIWKHEPWDLPdKSAVQSDNEWFFFSPRGRKYPNGSQSKRATESGYWKATGKERNVKS 135
                     579************************777.99***************666667899************************************** PP

             NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +++ +g+k+tLvf++grapkg++t+W+mhey +
  XP_009604784.1 136 -GSNMIGTKRTLVFHTGRAPKGQRTQWIMHEYCM 168
                     .99*****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-5639185IPR003441NAC domain
PROSITE profilePS5100554.07542186IPR003441NAC domain
PfamPF023652.2E-2644167IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 421 aa     Download sequence    Send to blast
MEDGDVSGST DENKARKIVQ RSENINGNDK NVGISVATAS TMFPGFRFCP TDEELISYYL  60
KKKLEGSDKC VEVISEVEIW KHEPWDLPDK SAVQSDNEWF FFSPRGRKYP NGSQSKRATE  120
SGYWKATGKE RNVKSGSNMI GTKRTLVFHT GRAPKGQRTQ WIMHEYCMTG NSYYQDSVVV  180
CRLRKNNEFH LNDTQGNRRN HLAVDCSTAL SGAAQLDSLD LINGGECCSK EGSSSFSSHS  240
VEKVESGSES DKLTKVLPQH NSSSHWKDCD EEDCFADIMK DDIVKLDDSS YKARQNLLPI  300
VTRKLESSTK STPQEFQDLM SHRLPFQGTA NRRLRLQTEI VPRRVEAYEA NKKNSRAADT  360
TRRLMINIIP VRRIKQWSIP LLLVSLVLAV IFLCLFGVPQ QVKWLGHLLV ITPPEVNTRP  420
A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-443818713166NO APICAL MERISTEM PROTEIN
1ut4_B9e-443818713166NO APICAL MERISTEM PROTEIN
1ut7_A9e-443818713166NO APICAL MERISTEM PROTEIN
1ut7_B9e-443818713166NO APICAL MERISTEM PROTEIN
3swm_A8e-443818716169NAC domain-containing protein 19
3swm_B8e-443818716169NAC domain-containing protein 19
3swm_C8e-443818716169NAC domain-containing protein 19
3swm_D8e-443818716169NAC domain-containing protein 19
3swp_A8e-443818716169NAC domain-containing protein 19
3swp_B8e-443818716169NAC domain-containing protein 19
3swp_C8e-443818716169NAC domain-containing protein 19
3swp_D8e-443818716169NAC domain-containing protein 19
4dul_A9e-443818713166NAC domain-containing protein 19
4dul_B9e-443818713166NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754452e-88HG975445.1 Solanum pennellii chromosome ch06, complete genome.
GenBankHG9754502e-88HG975450.1 Solanum pennellii chromosome ch11, complete genome.
GenBankHG9755232e-88HG975523.1 Solanum lycopersicum chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009604784.10.0PREDICTED: NAC domain-containing protein 89-like
TrEMBLM1BQC90.0M1BQC9_SOLTU; Uncharacterized protein
STRINGSolyc11g068750.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41542243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44290.14e-85NAC domain containing protein 60